RetrogeneDB ID: | retro_ggor_1093 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 14:26166632..26166937(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DDA1 | ||
Ensembl ID: | ENSGGOG00000005802 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 87.38 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQW-DKKNAA |
MADFLKGLPVYNKSNFSRFH.DSVCKASN.RPSVYLPTREYPSEQIIVTEKTNILLRYLHQQW.DKKNAA | |
Retrocopy | MADFLKGLPVYNKSNFSRFHGDSVCKASNQRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQW<DKKNAA |
Parental | KKRDQEQVELEGESSAPPRKVARTDSPDMHEDT |
KK.DQEQVELEGE.SAP.R..A.T.SP...EDT | |
Retrocopy | KKKDQEQVELEGETSAPLRQLALTHSPEIQEDT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .10 RPM | 34 .14 RPM |
SRP007412_cerebellum | 0 .28 RPM | 9 .81 RPM |
SRP007412_heart | 0 .06 RPM | 12 .79 RPM |
SRP007412_kidney | 0 .00 RPM | 10 .06 RPM |
SRP007412_liver | 0 .05 RPM | 9 .21 RPM |
SRP007412_testis | 0 .00 RPM | 35 .02 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1409 |
Pan troglodytes | retro_ptro_966 |
Pongo abelii | retro_pabe_1167 |
Macaca mulatta | retro_mmul_2248 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000017068 | 3 retrocopies | |
Canis familiaris | ENSCAFG00000031251 | 3 retrocopies | |
Cavia porcellus | ENSCPOG00000006944 | 1 retrocopy | |
Felis catus | ENSFCAG00000001001 | 1 retrocopy | |
Homo sapiens | ENSG00000130311 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000005802 | 1 retrocopy |
retro_ggor_1093 ,
|
Microcebus murinus | ENSMICG00000001763 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000003990 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000016231 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000005738 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000003701 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000009710 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000010668 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000039417 | 1 retrocopy |