RetrogeneDB ID: | retro_ggor_1390 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 18:67189652..67189995(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SDHC | ||
Ensembl ID: | ENSGGOG00000008017 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 76.52 % |
Parental protein coverage: | 98.28 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | ALLLSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYLELLKSLCLGPALIH-TAKFALVFPL |
AL...W.LPM.MS.CH.G.GIALSA.V.LFGMS.LLLPGNFESYL.L.KSLCLGPALIH.TA..AL.FPL | |
Retrocopy | ALSTVWPLPMTMSLCHCGSGIALSARVCLFGMSVLLLPGNFESYLKLVKSLCLGPALIH>TATLALLFPL |
Parental | MYHTWNGIRHLMWDLGKGLKIPQLYQSGVVVLVLTVLSSVGLAAM |
M.HTW.GI..LMW.LG..LKIPQL.QS.VVVLVLTVL.SVGLAAM | |
Retrocopy | MCHTWSGISPLMWYLGIALKIPQLHQSRVVVLVLTVLWSVGLAAM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 12 .18 RPM |
SRP007412_cerebellum | 0 .04 RPM | 8 .08 RPM |
SRP007412_heart | 0 .00 RPM | 12 .16 RPM |
SRP007412_kidney | 0 .00 RPM | 35 .12 RPM |
SRP007412_liver | 0 .00 RPM | 18 .94 RPM |
SRP007412_testis | 0 .10 RPM | 12 .12 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000015351 | 2 retrocopies | |
Bos taurus | ENSBTAG00000015853 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000012992 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000004757 | 3 retrocopies | |
Echinops telfairi | ENSETEG00000015767 | 1 retrocopy | |
Felis catus | ENSFCAG00000000499 | 1 retrocopy | |
Homo sapiens | ENSG00000143252 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000008017 | 3 retrocopies |
retro_ggor_1390 , retro_ggor_536, retro_ggor_697,
|
Macaca mulatta | ENSMMUG00000012411 | 11 retrocopies | |
Mustela putorius furo | ENSMPUG00000014439 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000014367 | 3 retrocopies | |
Pteropus vampyrus | ENSPVAG00000005544 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000003163 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000016835 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000030318 | 2 retrocopies | |
Takifugu rubripes | ENSTRUG00000001873 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000009234 | 1 retrocopy |