RetrogeneDB ID: | retro_ggor_1658 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 2a:110833185..110833611(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | POLR2D | ||
Ensembl ID: | ENSGGOG00000004723 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 85.62 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | MAAGGSDPRAGDVEEDASQLIFPKEIEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTL-NY |
MAAGGSDPRA.DVEED.SQL.FPKE..FETAETLLNSEVHMLLEHRKQ.NESAEDEQELSEVFMKT..NY | |
Retrocopy | MAAGGSDPRADDVEEDTSQLLFPKE--FETAETLLNSEVHMLLEHRKQ*NESAEDEQELSEVFMKTM>NY |
Parental | TARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFE-DEELQQILDDIQT |
..RFS.F.NRETIASVRSLLL.K.LHKFEL.CLANLCPETAEESKALIP.LEG.FE..EELQQ.LDDIQT | |
Retrocopy | KGRFSGFENRETIASVRSLLL*KNLHKFELVCLANLCPETAEESKALIPNLEGWFE<SEELQQVLDDIQT |
Parental | KRSFQY |
K.SFQY | |
Retrocopy | KHSFQY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 24 .46 RPM |
SRP007412_cerebellum | 0 .00 RPM | 15 .92 RPM |
SRP007412_heart | 0 .00 RPM | 11 .13 RPM |
SRP007412_kidney | 0 .00 RPM | 23 .63 RPM |
SRP007412_liver | 0 .00 RPM | 17 .73 RPM |
SRP007412_testis | 0 .10 RPM | 103 .50 RPM |
Species | RetrogeneDB ID |
---|---|
Pan troglodytes | retro_ptro_1571 |
Pongo abelii | retro_pabe_1933 |
Macaca mulatta | retro_mmul_1011 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011746 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000004311 | 2 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000013850 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000008527 | 1 retrocopy | |
Felis catus | ENSFCAG00000027816 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000004723 | 1 retrocopy |
retro_ggor_1658 ,
|
Macaca mulatta | ENSMMUG00000001989 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000018653 | 4 retrocopies | |
Mustela putorius furo | ENSMPUG00000016685 | 1 retrocopy | |
Mus musculus | ENSMUSG00000024258 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000021449 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000005327 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000012759 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000012436 | 1 retrocopy | |
Sorex araneus | ENSSARG00000009037 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000014817 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000023329 | 3 retrocopies |