RetrogeneDB ID: | retro_mdom_689 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 2:104227401..104227780(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSMODG00000018653 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 64.34 % |
Parental protein coverage: | 88.73 % |
Number of stop codons detected: | 6 |
Number of frameshifts detected | 3 |
Parental | EDASQLVFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV-FMKTLNYTARFSRFKNRETIASV |
ED..QLVFPKE.E.AETLL..E.H.LLE..KQQNES..DE.ELS.V..MKT.N....FS.F.NR.TIAS. | |
Retrocopy | EDT*QLVFPKELEIAETLLK*EIHLLLELWKQQNESSKDE*ELSMV<LMKT*NHCTLFSNFYNRKTIASI |
Parental | RS-LLLQK-KLHKFELACLANLCPETAEEAKALIPSLEGRFEDEELQQILDDIQTKRSF |
.S.L.L.K.KL....LACL..LCPE.AEEAK..IPSLEG..E.E.LQQILD..QTKR.F | |
Retrocopy | WS>LVL*K>KLPEL*LACLVSLCPEPAEEAKVPIPSLEGPSENEGLQQILDNSQTKRDF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011746 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000004311 | 2 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000013850 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000008527 | 1 retrocopy | |
Felis catus | ENSFCAG00000027816 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000004723 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000001989 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000018653 | 4 retrocopies | |
Mustela putorius furo | ENSMPUG00000016685 | 1 retrocopy | |
Mus musculus | ENSMUSG00000024258 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000021449 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000005327 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000012759 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000012436 | 1 retrocopy | |
Sorex araneus | ENSSARG00000009037 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000014817 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000023329 | 3 retrocopies |