RetrogeneDB ID: | retro_ggor_1999 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 3:175367873..175368188(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C11ORF51 | ||
Ensembl ID: | ENSGGOG00000012501 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 56.14 % |
Parental protein coverage: | 92.56 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 2 |
Parental | PRVTETLWF-NLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEE |
P.VT.TL.F.NL...CVEETELQQQEQQH.A...S..EKDNNL.P...P.S..Y...E.E.......... | |
Retrocopy | PEVTDTL*F>NLY*TCVEETELQQQEQQHEAF--SFTEKDNNLLP--EPGSKNY---EDEGEDYEDEEDS |
Parental | DS-EDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI |
.....DE.MQDMD.MND.NE.P.DGEVN.VD..GN.QDQD.W.I | |
Retrocopy | KK<MEDEHMQDMDDMNDFNE*PGDGEVNDVDVGGNKQDQDKWTI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 2 .64 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .91 RPM |
SRP007412_heart | 0 .00 RPM | 1 .56 RPM |
SRP007412_kidney | 0 .00 RPM | 3 .76 RPM |
SRP007412_liver | 0 .00 RPM | 1 .71 RPM |
SRP007412_testis | 0 .00 RPM | 4 .87 RPM |
Species | RetrogeneDB ID |
---|---|
Pongo abelii | retro_pabe_2388 |
Bos taurus | retro_btau_269 |
Equus caballus | retro_ecab_470 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000010843 | 1 retrocopy | |
Bos taurus | ENSBTAG00000002999 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000005781 | 1 retrocopy | |
Equus caballus | ENSECAG00000021041 | 1 retrocopy | |
Felis catus | ENSFCAG00000005321 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000012501 | 2 retrocopies |
retro_ggor_1999 , retro_ggor_2977,
|
Myotis lucifugus | ENSMLUG00000014120 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000010260 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000015797 | 1 retrocopy | |
Sorex araneus | ENSSARG00000004171 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000014179 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000010773 | 1 retrocopy |