RetrogeneDB ID: | retro_pvam_404 | ||
Retrocopy location | Organism: | Megabat (Pteropus vampyrus) | |
| Coordinates: | GeneScaffold_2958:293421..293697(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ANAPC15 | ||
| Ensembl ID: | ENSPVAG00000015797 | ||
| Aliases: | None | ||
| Description: | anaphase promoting complex subunit 15 [Source:HGNC Symbol;Acc:24531] |
| Percent Identity: | 70.97 % |
| Parental protein coverage: | 76.86 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | ELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDEDDDEDSEEDSEDDEDMQDMDEMNDYNES |
| .L.QQE.QHQAWLQSI.EKDNNLV...K.ASE.YDD..EED..D..DSE.DSE.DEDMQDMDEM.DY... | |
| Retrocopy | QLHQQE*QHQAWLQSIMEKDNNLVFLFKTASEQYDDMKEEDD*DAKDSE-DSENDEDMQDMDEMCDYSA* |
| Parental | PDDGEVNEVDMEGNEQDQDQWMI |
| ..D.EV.EVDMEGNEQDQDQW.. | |
| Retrocopy | LNDREVIEVDMEGNEQDQDQWIM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010843 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000002999 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000005781 | 1 retrocopy | |
| Equus caballus | ENSECAG00000021041 | 1 retrocopy | |
| Felis catus | ENSFCAG00000005321 | 1 retrocopy | |
| Homo sapiens | ENSG00000110200 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000012501 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000014120 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016270 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000010260 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017234 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000003646 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000015797 | 1 retrocopy |
retro_pvam_404 ,
|
| Sorex araneus | ENSSARG00000004171 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000014179 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010773 | 1 retrocopy |