RetrogeneDB ID: | retro_pvam_404 | ||
Retrocopylocation | Organism: | Megabat (Pteropus vampyrus) | |
Coordinates: | GeneScaffold_2958:293421..293697(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ANAPC15 | ||
Ensembl ID: | ENSPVAG00000015797 | ||
Aliases: | None | ||
Description: | anaphase promoting complex subunit 15 [Source:HGNC Symbol;Acc:24531] |
Percent Identity: | 70.97 % |
Parental protein coverage: | 76.86 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | ELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDEDDDEDSEEDSEDDEDMQDMDEMNDYNES |
.L.QQE.QHQAWLQSI.EKDNNLV...K.ASE.YDD..EED..D..DSE.DSE.DEDMQDMDEM.DY... | |
Retrocopy | QLHQQE*QHQAWLQSIMEKDNNLVFLFKTASEQYDDMKEEDD*DAKDSE-DSENDEDMQDMDEMCDYSA* |
Parental | PDDGEVNEVDMEGNEQDQDQWMI |
..D.EV.EVDMEGNEQDQDQW.. | |
Retrocopy | LNDREVIEVDMEGNEQDQDQWIM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000010843 | 1 retrocopy | |
Bos taurus | ENSBTAG00000002999 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000005781 | 1 retrocopy | |
Equus caballus | ENSECAG00000021041 | 1 retrocopy | |
Felis catus | ENSFCAG00000005321 | 1 retrocopy | |
Homo sapiens | ENSG00000110200 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000012501 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000014120 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000016270 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000010260 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000017234 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000003646 | 2 retrocopies | |
Pteropus vampyrus | ENSPVAG00000015797 | 1 retrocopy |
retro_pvam_404 ,
|
Sorex araneus | ENSSARG00000004171 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000014179 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000010773 | 1 retrocopy |