RetrogeneDB ID: | retro_lafr_1252 | ||
Retrocopylocation | Organism: | Elephant (Loxodonta africana) | |
Coordinates: | scaffold_98:2168160..2168584(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CCDC90A | ||
Ensembl ID: | ENSLAFG00000003287 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 57.24 % |
Parental protein coverage: | 67.62 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | QEITLQQVMSQIASVK-KDMIILEKSEFS-ALRAENEKIKLELLQLKQQVTDEMIKVRTDTKLDFNLEKS |
Q..TL.Q..SQ.A.V..K....LEKSEF...LRAENEKIK....QLK.Q......K...DTKLD..LE.S | |
Retrocopy | QTTTLGQTTSQSAGVG<KGVMVLEKSEFF>SLRAENEKIKIKPCQLKRQGMKDS-KYEADTKLDLDLERS |
Parental | RVKELYSLNERKLLEMRTEVVALHAQ-QDRALTQTDRKIDTEVAGLKTMLESHKLDNIKYLAGSVFTCLT |
.VKE.YSLNERKL.EMR....AL..Q.QD.A...TD...DTE.AG..T...SHK.DN.KYLA.SVF.CLT | |
Retrocopy | *VKEQYSLNERKLSEMRAAAAALRDQ>QDWAHSHTDQVTDTEAAGPQTLPKSHKFDNVKYLARSVFKCLT |
Parental | VALGF |
.A.GF | |
Retrocopy | EAVGF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000000395 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000009857 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000016050 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000014899 | 1 retrocopy | |
Equus caballus | ENSECAG00000009150 | 2 retrocopies | |
Felis catus | ENSFCAG00000005972 | 3 retrocopies | |
Homo sapiens | ENSG00000050393 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000002632 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000003287 | 2 retrocopies |
retro_lafr_1252 , retro_lafr_870,
|
Microcebus murinus | ENSMICG00000000183 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000010975 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000000698 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000000914 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000013458 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000017740 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000012562 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000012874 | 1 retrocopy |