RetrogeneDB ID: | retro_lafr_574 | ||
Retrocopylocation | Organism: | Elephant (Loxodonta africana) | |
Coordinates: | scaffold_22:22937784..22937996(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ARPP19 | ||
Ensembl ID: | ENSLAFG00000000755 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 58.11 % |
Parental protein coverage: | 63.39 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 3 |
Parental | MSAEIPEAAS-VEEQKEMED-KVTNPEKAEEAKLKARYPHLGQKP-GGSDFLRKRLQKGQKYFDSGDYNM |
MS.EI.E..S...EQKEM.........KAEEAKLKARYPHL.QKP...SD.LRK.LQKG.....S.DY.. | |
Retrocopy | MSVEIFEVPS<KKEQKEMKE<EGISTVKAEEAKLKARYPHLVQKP>*NSDSLRKQLQKG*INLYSRDYDV |
Parental | AKAK |
.KAK | |
Retrocopy | SKAK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dipodomys ordii | ENSDORG00000011321 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000025250 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000000755 | 2 retrocopies |
retro_lafr_1058, retro_lafr_574 ,
|
Loxodonta africana | ENSLAFG00000011261 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000013865 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000006487 | 2 retrocopies |