RetrogeneDB ID: | retro_mdom_1165 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 3:328735894..328736117(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TRAPPC2L | ||
Ensembl ID: | ENSMODG00000003889 | ||
Aliases: | None | ||
Description: | trafficking protein particle complex 2-like [Source:HGNC Symbol;Acc:30887] |
Percent Identity: | 53.33 % |
Parental protein coverage: | 52.52 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | KALVDQRELYLGLLYPT-EDYKVYGYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYT-DVMCNPF |
K.LVDQRE.Y..LL.P..E.Y...GYV..SK.KFV.....S...L.DN...SM...LHNSY...V..NPF | |
Retrocopy | KRLVDQRESY*NLLCPPREGYQISGYVAHSKRKFVTMLGPSSITLWDNNMHSML*RLHNSYS>GVIHNPF |
Parental | YNPGD |
.NPGD | |
Retrocopy | HNPGD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Echinops telfairi | ENSETEG00000003547 | 1 retrocopy | |
Homo sapiens | ENSG00000167515 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000003889 | 2 retrocopies |
retro_mdom_1165 , retro_mdom_1391,
|
Rattus norvegicus | ENSRNOG00000014581 | 3 retrocopies |