RetrogeneDB ID: | retro_mdom_1391 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 4:268518521..268518746(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TRAPPC2L | ||
Ensembl ID: | ENSMODG00000003889 | ||
Aliases: | None | ||
Description: | trafficking protein particle complex 2-like [Source:HGNC Symbol;Acc:30887] |
Percent Identity: | 64.94 % |
Parental protein coverage: | 53.24 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 2 |
Parental | DYKVYG-YVTNSKVKFVMVVDSSNTALRDN-EIRSMFRKL-HNSYTDVMCNPFYNPGDRIHSRAFDNMVT |
D..VY..Y.TN.K.KFV.V..SSNTAL....EI..MF.KL.HNSY.DV..NP..NPG..IH.RAFDNM.T | |
Retrocopy | DNRVYS<YATNPKIKFVRVLNSSNTAL*ES>EICIMF*KLLHNSYADVVYNPS*NPGVYIHYRAFDNMMT |
Parental | SMMVQVC |
SMMVQVC | |
Retrocopy | SMMVQVC |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Echinops telfairi | ENSETEG00000003547 | 1 retrocopy | |
Homo sapiens | ENSG00000167515 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000003889 | 2 retrocopies |
retro_mdom_1165, retro_mdom_1391 ,
|
Rattus norvegicus | ENSRNOG00000014581 | 3 retrocopies |