RetrogeneDB ID: | retro_mdom_1739 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 7:148270704..148271133(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ATP6V0C | ||
Ensembl ID: | ENSMODG00000015439 | ||
Aliases: | None | ||
Description: | ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c [Source:HGNC Symbol;Acc:855] |
Percent Identity: | 60.84 % |
Parental protein coverage: | 78.57 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | SFFAIMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANAVT |
SFF..M.AS.AM..S.LG.AY.TAKS...I.AM.VMR.ELIMKSIIP...A...AIY.LV..VLI.N..T | |
Retrocopy | SFFTLMAASVAMFSSSLGVAYNTAKSSLTISAM*VMRAELIMKSIIPIFIADFLAIYDLVMVVLIVNSLT |
Parental | PAITLFKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALI |
..I.LFK.F..L.AGL...L..L..GFAI.I.GD.GV..T.Q...LF.GM.LILIF.E.LGLYGLIVA.I | |
Retrocopy | LRIILFKTFH*LEAGLNMQLIRLEFGFAIDIIGDVGVLKTVQ*SKLFLGMNLILIFPEMLGLYGLIVAYI |
Parental | LST |
.ST | |
Retrocopy | FST |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000026428 | 1 retrocopy | |
Homo sapiens | ENSG00000185883 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000028600 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000004597 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000026715 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000015439 | 5 retrocopies | |
Mus musculus | ENSMUSG00000024121 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000009416 | 2 retrocopies | |
Procavia capensis | ENSPCAG00000015060 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000007653 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000006542 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000014251 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000013420 | 3 retrocopies | |
Drosophila melanogaster | FBgn0262736 | 3 retrocopies | |
Caenorhabditis elegans | R10E11.2 | 2 retrocopies |