RetrogeneDB ID: | retro_mdom_952 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 3:11351290..11351650(+) | ||
Located in intron of: | ENSMODG00000019413 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX11 | ||
Ensembl ID: | ENSMODG00000014855 | ||
Aliases: | None | ||
Description: | cytochrome c oxidase assembly homolog 11 (yeast) [Source:HGNC Symbol;Acc:2261] |
Percent Identity: | 62.4 % |
Parental protein coverage: | 51.9 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | FNADVHASLHWNFRPQQTEIYVVPGETALAFYKAKNPTDKSVIGISTYNVVPFEAGQYFNKIQCFC-FEE |
F.A.V.ASL..........IY.V..........AK.PTDK.V.GIST.NVVPFEAG..FN....F..FEE | |
Retrocopy | FDAHVQASLSPGILDLNKPIYGVRAGSGI--FQAKTPTDKPVFGISTSNVVPFEAGRDFNTMGSFV<FEE |
Parental | QRLNPQEEVDMPVFFFIDPEFAEDPKMAKVDVITLSYT-FFEAKEGHKLPVPGYN |
QRLN..EEVDMPVFFF.DPEFAEDPKMAKVDV.TLSYT.F...K..H.LPVPGYN | |
Retrocopy | QRLNAPEEVDMPVFFFTDPEFAEDPKMAKVDVVTLSYT>FLKQKD-HQLPVPGYN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000008482 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000014862 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000001207 | 1 retrocopy | |
Homo sapiens | ENSG00000166260 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000005225 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000014855 | 1 retrocopy |
retro_mdom_952 ,
|
Mus musculus | ENSMUSG00000020544 | 4 retrocopies | |
Nomascus leucogenys | ENSNLEG00000007990 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000004138 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000008259 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000009422 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000046318 | 1 retrocopy |