RetrogeneDB ID: | retro_meug_286 | ||
Retrocopy location | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | GeneScaffold_9412:14117..14327(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LIN52 | ||
| Ensembl ID: | ENSMEUG00000007891 | ||
| Aliases: | None | ||
| Description: | lin-52 homolog (C. elegans) [Source:HGNC Symbol;Acc:19856] |
| Percent Identity: | 74.29 % |
| Parental protein coverage: | 60.34 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MGRKMASPTDGTDLEASLLSFEKLDRASPDLWPEQXXXXXXXXXXXXXPITSSPPKWMAELEHDDIDMLK |
| MG.KMASPTDGT.LEA.LLSFEKLD.ASPDLWPEQ.............PITSSPPKWMA.LEHDDIDMLK | |
| Retrocopy | MGWKMASPTDGTNLEALLLSFEKLDQASPDLWPEQLPGVAEFAASFKSPITSSPPKWMAKLEHDDIDMLK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Loxodonta africana | ENSLAFG00000002534 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000007891 | 1 retrocopy |
retro_meug_286 ,
|
| Mus musculus | ENSMUSG00000085793 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000017491 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000003009 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000008100 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000005405 | 1 retrocopy |