RetrogeneDB ID: | retro_meug_878 | ||
Retrocopy location | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | Scaffold2180:33252..33469(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMEUG00000004963 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 54.79 % |
| Parental protein coverage: | 50.35 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | LKAAVHYNGGSLGQEAVVDKDMFSKTTVVISEVTFQQHEHFARDLELFARH-AKRSTINMEDVKLLARRS |
| LKAAVH...GS..QEA.........TT.V.SEVTFQQ.E.FA.DLE.FAR........NME..KLLAR.. | |
| Retrocopy | LKAAVHNTTGSASQEAAKETEFSKPTTTVPSEVTFQQCEIFAKDLEIFARR>XXXGAANMEGEKLLARSN |
| Parental | SSL |
| .SL | |
| Retrocopy | NSL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000004967 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000006387 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000004963 | 1 retrocopy |
retro_meug_878 ,
|