RetrogeneDB ID: | retro_mmul_1130 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 14:128603747..128604179(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BAK1 | ||
| Ensembl ID: | ENSMMUG00000009104 | ||
| Aliases: | None | ||
| Description: | bcl-2 homologous antagonist/killer [Source:RefSeq peptide;Acc:NP_001253660] |
| Percent Identity: | 86.21 % |
| Parental protein coverage: | 68.72 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | PSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIASSLFESGINWGRVVALLGFGY |
| PSST.GQVG.Q.AII.DDINRRYDSEF.TMLQHLQPTAENAYEYFTKIASSLFESGIN.GRVVALLGFGY | |
| Retrocopy | PSSTVGQVGWQIAIIWDDINRRYDSEF*TMLQHLQPTAENAYEYFTKIASSLFESGINQGRVVALLGFGY |
| Parental | RLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVR |
| .L.LHVYQ.GLTGFLGQVTRFVV.FML.HCI..WIAQR..WVAAL.LGNGPILNVLV.LGVVLLG.FVV. | |
| Retrocopy | HLVLHVYQRGLTGFLGQVTRFVV-FML*HCITWWIAQRSSWVAALDLGNGPILNVLVILGVVLLGLFVVQ |
| Parental | RFFKS |
| .FFKS | |
| Retrocopy | GFFKS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 4 .71 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 9 .60 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 7 .49 RPM |
| SRP007412_heart | 0 .00 RPM | 10 .83 RPM |
| SRP007412_kidney | 0 .00 RPM | 16 .20 RPM |
| SRP007412_liver | 0 .00 RPM | 6 .45 RPM |
| SRP007412_testis | 0 .00 RPM | 4 .15 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_942 |
| Pan troglodytes | retro_ptro_652 |
| Gorilla gorilla | retro_ggor_761 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Felis catus | ENSFCAG00000013657 | 1 retrocopy | |
| Homo sapiens | ENSG00000030110 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000022462 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000009104 | 1 retrocopy |
retro_mmul_1130 ,
|
| Nomascus leucogenys | ENSNLEG00000008351 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000001127 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000018053 | 1 retrocopy |