RetrogeneDB ID: | retro_mmul_1249 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 16:18338774..18339032(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.9638 | ||
| Ensembl ID: | ENSMMUG00000007039 | ||
| Aliases: | None | ||
| Description: | coactosin-like protein [Source:RefSeq peptide;Acc:NP_001248084] |
Retrocopy-Parental alignment summary:
>retro_mmul_1249
ATGGCCACCAAGATTGACAAAGAGGCTTGCCGGGAGGCCTACAACCTAGCACAAGACGACAGATTGGCCGTCATCTGGGT
GACTTTTAAATATGATGGCTCCATCATCGTCCCTGTCAGGCAAGGAGCAGAATACCAGCACTTCATCCTGCAGCGTACAG
ACGAGGTCTGGTTGCTTGCCTTCGTGTGTGTCACCACAGGGGATGCCATGAGCAGGAGGTCCATGTTTGCCCTCATCAGG
TAGATTGGCAAGAACGTC
ORF - retro_mmul_1249 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 76.74 % |
| Parental protein coverage: | 60.56 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAM |
| MATKIDKEACR.AYNL..DD..AVIWVTFKYDGS.IVP..QGAEYQHFI.Q.TD.V.L.AFV..TTGDAM | |
| Retrocopy | MATKIDKEACREAYNLAQDDRLAVIWVTFKYDGSIIVPVRQGAEYQHFILQRTDEVWLLAFVCVTTGDAM |
| Parental | SKRSKFALITWIGENV |
| S.RS.FALI..IG.NV | |
| Retrocopy | SRRSMFALIR*IGKNV |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 16 .25 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 30 .54 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 22 .21 RPM |
| SRP007412_heart | 0 .00 RPM | 6 .95 RPM |
| SRP007412_kidney | 0 .00 RPM | 97 .53 RPM |
| SRP007412_liver | 0 .00 RPM | 34 .60 RPM |
| SRP007412_testis | 0 .90 RPM | 28 .80 RPM |
Macaca mulatta was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_mmul_1249 retrocopy.
Macaca mulatta was not studied using FANTOM5 data.
retro_mmul_1249 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_mmul_1249 has 0 orthologous retrocopies within eutheria group .Parental genes homology:
Parental genes homology involve 2 parental genes, and 5 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000004056 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000007039 | 1 retrocopy |
retro_mmul_1249 ,
|