RetrogeneDB ID: | retro_mmul_1434 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 2:59610327..59610624(+) | ||
| Located in intron of: | ENSMMUG00000008549 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CRB3 | ||
| Ensembl ID: | ENSMMUG00000005599 | ||
| Aliases: | None | ||
| Description: | crumbs protein homolog 3 precursor [Source:RefSeq peptide;Acc:NP_001253010] |
| Percent Identity: | 67.33 % |
| Parental protein coverage: | 80.49 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | WGQRLASSAYDSSTVVPSPTSSSSNGNLSQE-AITAIIVVFSILAILLLAVGLALLVWKLREKRQTEGTY |
| W.Q....SA..SS.V.P.PTSS.SNG.LSQ..A.TAIIV.F..LA.L.LAVGLALLV.KLRE.RQTEGTY | |
| Retrocopy | WAQIPTPSANESSIVLPTPTSSGSNGALSQG>AVTAIIVFF*FLAVLFLAVGLALLVRKLREMRQTEGTY |
| Parental | RPSSEEQFSHAAE-ARAPQDSKETVRGCLPI |
| .PSSEEQFS..A..A.APQDS.ET..G.L.I | |
| Retrocopy | WPSSEEQFSYVAG<AWAPQDSNETLWGYLHI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .34 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 1 .59 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 1 .23 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .18 RPM |
| SRP007412_kidney | 0 .00 RPM | 8 .22 RPM |
| SRP007412_liver | 0 .00 RPM | 9 .90 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .11 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2747 |
| Gorilla gorilla | retro_ggor_1910 |
| Pongo abelii | retro_pabe_2222 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000016567 | 1 retrocopy | |
| Homo sapiens | ENSG00000130545 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000007070 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000005599 | 1 retrocopy |
retro_mmul_1434 ,
|
| Nomascus leucogenys | ENSNLEG00000015936 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009457 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000010367 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000047322 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000002396 | 1 retrocopy |