RetrogeneDB ID: | retro_mmul_166 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 4:129531198..129531372(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMMUG00000029426 | |
Aliases: | None | ||
Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MMU.2648 | ||
Ensembl ID: | ENSMMUG00000011336 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 85.96 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDIQ |
M..AVDEMF.EGAGPYVDL.EA.GST.LLMDLAANEKA.HADF.NDFEDLFDDDDIQ | |
Retrocopy | MNLAVDEMFLEGAGPYVDLEEAEGSTRLLMDLAANEKAFHADFLNDFEDLFDDDDIQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 15 .69 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 39 .51 RPM |
SRP007412_cerebellum | 0 .00 RPM | 12 .66 RPM |
SRP007412_heart | 0 .00 RPM | 35 .98 RPM |
SRP007412_kidney | 0 .00 RPM | 25 .82 RPM |
SRP007412_liver | 0 .00 RPM | 7 .64 RPM |
SRP007412_testis | 0 .04 RPM | 29 .10 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Homo sapiens | ENSG00000172428 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000011336 | 2 retrocopies |
retro_mmul_166 , retro_mmul_931,
|
Monodelphis domestica | ENSMODG00000013501 | 1 retrocopy | |
Mus musculus | ENSMUSG00000073616 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000000776 | 1 retrocopy |