RetrogeneDB ID: | retro_mmul_166 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 4:129531198..129531372(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMMUG00000029426 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.2648 | ||
| Ensembl ID: | ENSMMUG00000011336 | ||
| Aliases: | None | ||
| Description: | None |
Retrocopy-Parental alignment summary:
>retro_mmul_166
ATGAATCTGGCCGTGGACGAGATGTTCCTCGAGGGCGCCGGGCCTTACGTGGACCTAGAGGAGGCAGAAGGCAGCACGAG
GCTCTTGATGGACTTGGCAGCCAATGAAAAGGCCTTTCATGCAGACTTTTTAAATGATTTTGAAGATCTTTTTGATGATG
ATGACATCCAGTGA
ORF - retro_mmul_166 Open Reading Frame is conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 85.96 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | MKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDIQ |
| M..AVDEMF.EGAGPYVDL.EA.GST.LLMDLAANEKA.HADF.NDFEDLFDDDDIQ | |
| Retrocopy | MNLAVDEMFLEGAGPYVDLEEAEGSTRLLMDLAANEKAFHADFLNDFEDLFDDDDIQ |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 15 .69 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 39 .51 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 12 .66 RPM |
| SRP007412_heart | 0 .00 RPM | 35 .98 RPM |
| SRP007412_kidney | 0 .00 RPM | 25 .82 RPM |
| SRP007412_liver | 0 .00 RPM | 7 .64 RPM |
| SRP007412_testis | 0 .04 RPM | 29 .10 RPM |
Macaca mulatta was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_mmul_166 retrocopy.
Macaca mulatta was not studied using FANTOM5 data.
retro_mmul_166 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_mmul_166 has 0 orthologous retrocopies within eutheria group .Parental genes homology:
Parental genes homology involve 5 parental genes, and 6 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Homo sapiens | ENSG00000172428 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000011336 | 2 retrocopies |
retro_mmul_166 , retro_mmul_931,
|
| Monodelphis domestica | ENSMODG00000013501 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000073616 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000000776 | 1 retrocopy |