RetrogeneDB ID: | retro_mmul_270 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 3:2054193..2054532(+) | ||
| Located in intron of: | ENSMMUG00000022561 | ||
Retrocopy information | Ensembl ID: | ENSMMUG00000030498 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | KRTAP12-3 | ||
| Ensembl ID: | ENSMMUG00000022561 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 52.5 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | TSCCRPSSSVSLICRPVCSCSPGCQPTCCIPSPCQASCYMPVSCQPIIYVTPSCQSSGCCQPPCTTVLCR |
| TSCC.....V.L.C.P.C..S..CQP.CC.PSPCQ..C...VSC.P...V...C..SGCCQP.C.T...R | |
| Retrocopy | TSCCCSAPCVILLCQPLCGVSTCCQPACCVPSPCQVACCVSVSCKPVLCVASFCPTSGCCQPSCPTLVYR |
| Parental | PISCSAPSCC |
| P..CS.P.CC | |
| Retrocopy | PVTCSTPTCC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Loxodonta africana | ENSLAFG00000003471 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000022561 | 1 retrocopy |
retro_mmul_270 ,
|