RetrogeneDB ID: | retro_mmul_824 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 11:82578830..82579109(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMMUG00000006963 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.366 | ||
| Ensembl ID: | ENSMMUG00000000973 | ||
| Aliases: | None | ||
| Description: | p53 and DNA damage-regulated protein 1 [Source:RefSeq peptide;Acc:NP_001252911] |
| Percent Identity: | 70.21 % |
| Parental protein coverage: | 70.68 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPH |
| MLSP.AE..L.Y...VEEL.EEVL.DK.Q.VD.DTKRN.N.EGLRALQ..LSLSEDV..CF.NMF.KMPH | |
| Retrocopy | MLSPDAEQILWYQFKVEELVEEVLVDKQQVVDVDTKRNKNPEGLRALQNGLSLSEDV-ACFRNMFVKMPH |
| Parental | PETKEMIEKDQDHLDKEIEKLRKQ |
| P..KEMI.K.QDHLDK.IE...KQ | |
| Retrocopy | PQVKEMIKKNQDHLDKDIEIIQKQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 13 .78 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 26 .02 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 21 .50 RPM |
| SRP007412_heart | 0 .00 RPM | 18 .08 RPM |
| SRP007412_kidney | 0 .00 RPM | 21 .13 RPM |
| SRP007412_liver | 0 .00 RPM | 12 .27 RPM |
| SRP007412_testis | 0 .00 RPM | 46 .85 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1037 |
| Pan troglodytes | retro_ptro_707 |
| Gorilla gorilla | retro_ggor_818 |
| Pongo abelii | retro_pabe_869 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000020766 | 1 retrocopy | |
| Homo sapiens | ENSG00000088356 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000024924 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000003915 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000007377 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000000973 | 1 retrocopy |
retro_mmul_824 ,
|
| Nomascus leucogenys | ENSNLEG00000009712 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000016709 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000006403 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000010897 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000013368 | 1 retrocopy |