RetrogeneDB ID: | retro_mmur_242 | ||
Retrocopy location | Organism: | Mouse Lemur (Microcebus murinus) | |
| Coordinates: | GeneScaffold_1949:500582..500735(+) | ||
| Located in intron of: | ENSMICG00000003036 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMICG00000001639 | ||
| Aliases: | None | ||
| Description: | None |
Retrocopy-Parental alignment summary:
>retro_mmur_242
ATGTCTTCTCACAAGACTTTCAGAATCAAGAGAATTCTGGTCAAGAAACAGAAGCAAACTCATCCCATTCCCCAATGGAT
TTGGATGAGAACTGATAATAAAATCAGGTACAGCTCCAAGAGGAGTCATTGGAGAAGACCCAAGCTGGGCCTA
ORF - retro_mmur_242 Open Reading Frame is conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 66.67 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | MSSHKTFRIKRFLAKKQKQNRPIPQWXXXXXXXXXXYNSKRRHWRRTKLGL |
| MSSHKTFRIKR.L.KKQKQ..PIPQW..........Y.SKR.HWRR.KLGL | |
| Retrocopy | MSSHKTFRIKRILVKKQKQTHPIPQWIWMRTDNKIRYSSKRSHWRRPKLGL |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
Microcebus murinus was not studied using RNA-Seq expression data.
Microcebus murinus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_mmur_242 retrocopy.
Microcebus murinus was not studied using FANTOM5 data.
retro_mmur_242 was not experimentally validated.
Retrocopy orthology:
Microcebus murinus does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 1 parental gene, and 10 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Microcebus murinus | ENSMICG00000001639 | 10 retrocopies |
retro_mmur_1040, retro_mmur_1153, retro_mmur_159, retro_mmur_1612, retro_mmur_194, retro_mmur_242 , retro_mmur_389, retro_mmur_697, retro_mmur_770, retro_mmur_778,
|