RetrogeneDB ID: | retro_mmus_2220 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 3:10753892..10754286(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Vbp1 | ||
Ensembl ID: | ENSMUSG00000031197 | ||
Aliases: | None | ||
Description: | von Hippel-Lindau binding protein 1 [Source:MGI Symbol;Acc:MGI:1333804] |
Percent Identity: | 73.88 % |
Parental protein coverage: | 66.84 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | LAQKKRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLYCKASV-PPTDKVCLWLGANVMLEY |
L......LKGQIPEIKQTLEILKYMQK..E.TNSMETRFLLADNL.CKASV..PTDKVCLWLG.NVM..Y | |
Retrocopy | LRKMGKGLKGQIPEIKQTLEILKYMQKEQEPTNSMETRFLLADNLDCKASV<VPTDKVCLWLGTNVMPKY |
Parental | DIDEAQALLEKNLSTATKNLDSLEEDLDFLRDQ-FTTTEVNMARVYNWDVKR-RNKDDSTKNKA |
.IDEAQALLEKNLSTATKNL.SLE.D...L.DQ.FTTT....ARVYN.D.KR..NK...TKN.A | |
Retrocopy | IIDEAQALLEKNLSTATKNLHSLEKDHNCLQDQ>FTTTGIKIARVYNQD*KR>KNKSVPTKNNA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 32 .24 RPM |
SRP007412_cerebellum | 0 .00 RPM | 36 .60 RPM |
SRP007412_heart | 0 .00 RPM | 21 .57 RPM |
SRP007412_kidney | 0 .00 RPM | 23 .02 RPM |
SRP007412_liver | 0 .00 RPM | 7 .97 RPM |
SRP007412_testis | 0 .00 RPM | 4 .07 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000009058 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000019639 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000013652 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000019432 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000004628 | 2 retrocopies | |
Latimeria chalumnae | ENSLACG00000016144 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000015095 | 1 retrocopy | |
Mus musculus | ENSMUSG00000031197 | 1 retrocopy |
retro_mmus_2220 ,
|
Nomascus leucogenys | ENSNLEG00000014475 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000017448 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000016566 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000002823 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000012811 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000006684 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000007833 | 5 retrocopies | |
Tarsius syrichta | ENSTSYG00000002205 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000016258 | 1 retrocopy |