RetrogeneDB ID: | retro_mmus_956 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 12:84334383..84334618(-) | ||
| Located in intron of: | ENSMUSG00000042472 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Lsm6 | ||
| Ensembl ID: | ENSMUSG00000031683 | ||
| Aliases: | Lsm6, 1500031N17Rik, 2410088K19Rik, AI747288 | ||
| Description: | LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1925901] |
| Percent Identity: | 85.19 % |
| Parental protein coverage: | 98.75 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | SLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLK-NKYGDAFIRG-NN |
| SL.KQTPSDFLKQIIG.PVVVKLNSGV...G.LACLDGYMNIALEQT.EYVNGQL...KYGDAFI.G.NN | |
| Retrocopy | SLPKQTPSDFLKQIIGQPVVVKLNSGVNC*GLLACLDGYMNIALEQTGEYVNGQLE<DKYGDAFI*G<NN |
| Parental | VLYISTQKRRM |
| VLYISTQKRRM | |
| Retrocopy | VLYISTQKRRM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .19 RPM | 26 .73 RPM |
| SRP007412_cerebellum | 0 .17 RPM | 42 .99 RPM |
| SRP007412_heart | 0 .06 RPM | 16 .25 RPM |
| SRP007412_kidney | 0 .15 RPM | 19 .58 RPM |
| SRP007412_liver | 0 .14 RPM | 22 .07 RPM |
| SRP007412_testis | 0 .09 RPM | 10 .57 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000002482 | 4 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000009322 | 5 retrocopies | |
| Microcebus murinus | ENSMICG00000000571 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005524 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000020018 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000031683 | 2 retrocopies |
retro_mmus_820, retro_mmus_956 ,
|
| Otolemur garnettii | ENSOGAG00000026665 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015105 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000016488 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000012759 | 4 retrocopies |