RetrogeneDB ID: | retro_cjac_3248 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 9:101978974..101979213(+) | ||
Located in intron of: | ENSCJAG00000011989 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LSM6 | ||
Ensembl ID: | ENSCJAG00000002482 | ||
Aliases: | None | ||
Description: | LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:17017] |
Percent Identity: | 90.12 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDG-YMNIALEQTEEYVNGQLKNKYGDAFIRGNN |
MSL.KQTPSDFLKQII.RPVVVKLNSGVDYRGV.ACLD..YMN.ALEQTEEYVNGQLKNKYGDAFI.GNN | |
Retrocopy | MSLWKQTPSDFLKQIIRRPVVVKLNSGVDYRGVAACLDA<YMNTALEQTEEYVNGQLKNKYGDAFIQGNN |
Parental | VLYISTQKRRM |
VLYIS.QKRRM | |
Retrocopy | VLYISAQKRRM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .38 RPM | 6 .57 RPM |
SRP051959_heart | 0 .40 RPM | 5 .79 RPM |
SRP051959_kidney | 0 .82 RPM | 5 .77 RPM |
SRP051959_liver | 1 .32 RPM | 6 .41 RPM |
SRP051959_lung | 0 .62 RPM | 8 .82 RPM |
SRP051959_lymph_node | 0 .25 RPM | 8 .81 RPM |
SRP051959_skeletal_muscle | 0 .33 RPM | 5 .24 RPM |
SRP051959_spleen | 0 .48 RPM | 10 .36 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000002482 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000002705 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000009322 | 5 retrocopies | |
Microcebus murinus | ENSMICG00000000571 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005524 | 2 retrocopies | |
Mus musculus | ENSMUSG00000031683 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000026665 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000015105 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000016488 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000012759 | 4 retrocopies |