RetrogeneDB ID: | retro_nleu_1015 | ||
Retrocopy location | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397278.1:22158586..22158811(-) | ||
| Located in intron of: | ENSNLEG00000010262 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFA4L2 | ||
| Ensembl ID: | ENSNLEG00000017371 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 58.67 % |
| Parental protein coverage: | 86.21 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | QIKRHPGIIPMIGLTCLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKK |
| Q.K.H...I........G...AALYLL.LAL..PDV.WDRKNNPE.WN.L.PNDQYKF..V..DY.KLKK | |
| Retrocopy | QSKKHLSLISLFVFIGAGGTGAALYLLCLALFNPDVSWDRKNNPELWNKLAPNDQYKFYSVKVDYSKLKK |
| Parental | DRPDF |
| ...DF | |
| Retrocopy | EGLDF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000004466 | 1 retrocopy | |
| Homo sapiens | ENSG00000185633 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000021950 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000014358 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000017371 | 10 retrocopies |
retro_nleu_1015 , retro_nleu_1048, retro_nleu_1851, retro_nleu_1917, retro_nleu_2588, retro_nleu_2952, retro_nleu_363, retro_nleu_732, retro_nleu_862, retro_nleu_956,
|
| Ictidomys tridecemlineatus | ENSSTOG00000020476 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000015731 | 5 retrocopies |