RetrogeneDB ID: | retro_nleu_1015 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
Coordinates: | GL397278.1:22158586..22158811(-) | ||
Located in intron of: | ENSNLEG00000010262 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFA4L2 | ||
Ensembl ID: | ENSNLEG00000017371 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 58.67 % |
Parental protein coverage: | 86.21 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | QIKRHPGIIPMIGLTCLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKK |
Q.K.H...I........G...AALYLL.LAL..PDV.WDRKNNPE.WN.L.PNDQYKF..V..DY.KLKK | |
Retrocopy | QSKKHLSLISLFVFIGAGGTGAALYLLCLALFNPDVSWDRKNNPELWNKLAPNDQYKFYSVKVDYSKLKK |
Parental | DRPDF |
...DF | |
Retrocopy | EGLDF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Echinops telfairi | ENSETEG00000004466 | 1 retrocopy | |
Homo sapiens | ENSG00000185633 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000021950 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000014358 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000017371 | 10 retrocopies |
retro_nleu_1015 , retro_nleu_1048, retro_nleu_1851, retro_nleu_1917, retro_nleu_2588, retro_nleu_2952, retro_nleu_363, retro_nleu_732, retro_nleu_862, retro_nleu_956,
|
Ictidomys tridecemlineatus | ENSSTOG00000020476 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000015731 | 5 retrocopies |