RetrogeneDB ID: | retro_nleu_1982 | ||
Retrocopy location | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397321.1:394697..394850(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FXYD6 | ||
| Ensembl ID: | ENSNLEG00000007348 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 76.47 % |
| Parental protein coverage: | 53.68 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MELVLVFLCSLLAPTVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSV |
| ME..L.F.CSLL.P.VLASAA.KEKE.DPFHY.YQTLRIG.LVF.VVLF.V | |
| Retrocopy | MEVALIFVCSLLVPVVLASAA*KEKEIDPFHYNYQTLRIGRLVFDVVLFLV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000013044 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000011989 | 1 retrocopy | |
| Homo sapiens | ENSG00000137726 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000006473 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000007617 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000007348 | 2 retrocopies |
retro_nleu_1982 , retro_nleu_2890,
|
| Pongo abelii | ENSPPYG00000003918 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000004329 | 3 retrocopies |