RetrogeneDB ID: | retro_ocun_1182 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 3:11186908..11187246(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ARPP19 | ||
| Ensembl ID: | ENSOCUG00000015489 | ||
| Aliases: | None | ||
| Description: | cAMP-regulated phosphoprotein, 19kDa [Source:HGNC Symbol;Acc:16967] |
| Percent Identity: | 81.74 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MSAEVPETASAEEQKEMEDK--VTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMA |
| MSAEVPETASAEEQKEMED....TSPEKAEEAK.KA.YPH.GQK..GSDFLRKRLQKGQKYF...D.NMA | |
| Retrocopy | MSAEVPETASAEEQKEMEDRH*ETSPEKAEEAKSKAGYPHRGQKLRGSDFLRKRLQKGQKYFGFRDHNMA |
| Parental | -KAKMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG |
| .K.K...KQLPT.APD.TEVTGDHIPTPQDLP.RKPSLVASKLAG | |
| Retrocopy | <KSK-NEKQLPTVAPDETEVTGDHIPTPQDLPPRKPSLVASKLAG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 56 .68 RPM |
| SRP017611_kidney | 0 .00 RPM | 18 .45 RPM |
| SRP017611_liver | 0 .00 RPM | 5 .47 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000011022 | 5 retrocopies | |
| Canis familiaris | ENSCAFG00000032515 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000011228 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000004474 | 9 retrocopies | |
| Dipodomys ordii | ENSDORG00000011321 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000015550 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000025250 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000006551 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000003267 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000015489 | 10 retrocopies |
retro_ocun_1182 , retro_ocun_1297, retro_ocun_1398, retro_ocun_1573, retro_ocun_1731, retro_ocun_1768, retro_ocun_310, retro_ocun_473, retro_ocun_479, retro_ocun_698,
|
| Otolemur garnettii | ENSOGAG00000013865 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006487 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000004618 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000004804 | 1 retrocopy |