RetrogeneDB ID: | retro_ocun_1404 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 8:28909939..28910162(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ARL8A | ||
| Ensembl ID: | ENSOCUG00000023009 | ||
| Aliases: | None | ||
| Description: | ADP-ribosylation factor-like 8A [Source:HGNC Symbol;Acc:25192] |
| Percent Identity: | 70.13 % |
| Parental protein coverage: | 59.06 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | IPTVGFNMRKITK-GNVTIKLWDIG-GQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDK |
| IP.VGFN.RK.T..GNVTIK..D.G.GQPRF...WE.Y.RGVSA.VY..DAA..EKIEAS.NEL.NLLDK | |
| Retrocopy | IPWVGFNTRKVTQ<GNVTIKTRDVG<GQPRFWNTWE*YRRGVSAMVYVIDAAKLEKIEASPNELYNLLDK |
| Parental | PQLQGIP |
| PQ.QG.P | |
| Retrocopy | PQEQGTP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 31 .02 RPM |
| SRP017611_kidney | 0 .00 RPM | 3 .55 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .77 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Meleagris gallopavo | ENSMGAG00000001081 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000000824 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000014090 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000023009 | 1 retrocopy |
retro_ocun_1404 ,
|
| Oryctolagus cuniculus | ENSOCUG00000023198 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000023645 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000013990 | 1 retrocopy |