RetrogeneDB ID: | retro_ocun_1835 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | GL019195:6918..7094(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SERP1 | ||
| Ensembl ID: | ENSOCUG00000016085 | ||
| Aliases: | None | ||
| Description: | stress-associated endoplasmic reticulum protein 1 [Source:HGNC Symbol;Acc:10759] |
| Percent Identity: | 52.46 % |
| Parental protein coverage: | 90.91 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | IRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQ-SIRMGM |
| I.M..EKHSKN........KTS.N...EK.SVG....AL..F.VC..A..QIIQ.SI.MGM | |
| Retrocopy | IPMVKEKHSKNVIRGSSFSKTSKNELKEKESVGLVIGALH-FLVCCCATLQIIQ<SILMGM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 11 .53 RPM |
| SRP017611_kidney | 0 .00 RPM | 27 .67 RPM |
| SRP017611_liver | 0 .00 RPM | 12 .87 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000013995 | 15 retrocopies | |
| Microcebus murinus | ENSMICG00000000414 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000016085 | 2 retrocopies |
retro_ocun_1542, retro_ocun_1835 ,
|