RetrogeneDB ID: | retro_ocun_355 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 1:32265499..32265745(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BET1 | ||
| Ensembl ID: | ENSOCUG00000017029 | ||
| Aliases: | None | ||
| Description: | Bet1 golgi vesicular membrane trafficking protein [Source:HGNC Symbol;Acc:14562] |
| Percent Identity: | 80.49 % |
| Parental protein coverage: | 69.49 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | EENERLTESLRSKVTAIKSLSIEIGHEVKNQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTKLLCY |
| ....RLTE.LRSKVT.IKSL.I.IGHEVKNQNKLLAEMDSQFDS.TGF.GKTMGKL.IL..G.QTKLLCY | |
| Retrocopy | KKKTRLTENLRSKVTVIKSLYIVIGHEVKNQNKLLAEMDSQFDSVTGFQGKTMGKLEILPKGNQTKLLCY |
| Parental | MMLFSLFVFFVI |
| .MLFSLFVFFV. | |
| Retrocopy | RMLFSLFVFFVL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 17 .99 RPM |
| SRP017611_kidney | 0 .00 RPM | 20 .78 RPM |
| SRP017611_liver | 0 .00 RPM | 3 .78 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000003424 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001276 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013720 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000001012 | 3 retrocopies | |
| Homo sapiens | ENSG00000105829 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000002176 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000000587 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000000007 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000015441 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000017029 | 2 retrocopies |
retro_ocun_1116, retro_ocun_355 ,
|
| Ochotona princeps | ENSOPRG00000004536 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000019408 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000011008 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000015325 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000000765 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000009729 | 2 retrocopies |