RetrogeneDB ID: | retro_ogar_1025 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873534.1:5645984..5646236(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSOGAG00000003376 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 64.71 % |
| Parental protein coverage: | 69.67 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | NRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEVIHNQLLEKQRIAEEKIKELEQKKSYLERSVKE |
| ...KKH.HLTD.E.MTLV...N.Y.GVGRMFI.QSKEVIHNQLLEKQR..EEK.......KSY.E...KE | |
| Retrocopy | SQRKKHVHLTDIEVMTLVNKSNIYDGVGRMFIPQSKEVIHNQLLEKQRLTEEKVNP-TGRKSYWEQRFKE |
| Parental | AEDNIREMLMARRAQ |
| AED.I.EML.A..AQ | |
| Retrocopy | AEDSI*EMLIAGKAQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000005742 | 8 retrocopies | |
| Equus caballus | ENSECAG00000011843 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000005357 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000019281 | 1 retrocopy | |
| Felis catus | ENSFCAG00000001272 | 1 retrocopy | |
| Homo sapiens | ENSG00000113068 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000002726 | 3 retrocopies | |
| Microcebus murinus | ENSMICG00000000349 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000009432 | 4 retrocopies | |
| Otolemur garnettii | ENSOGAG00000003376 | 6 retrocopies |
retro_ogar_1025 , retro_ogar_1216, retro_ogar_1412, retro_ogar_2217, retro_ogar_3129, retro_ogar_89,
|
| Pan troglodytes | ENSPTRG00000017310 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000018653 | 1 retrocopy |