RetrogeneDB ID: | retro_ogar_880 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873530.1:4313217..4313466(+) | ||
| Located in intron of: | ENSOGAG00000013716 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CCDC167 | ||
| Ensembl ID: | ENSOGAG00000000921 | ||
| Aliases: | None | ||
| Description: | coiled-coil domain containing 167 [Source:HGNC Symbol;Acc:21239] |
| Percent Identity: | 92.77 % |
| Parental protein coverage: | 86.46 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | QIDGLEEKLSQCQRDLEAVNSRLHRAELSPEARKSLEKEKNSLMSKASNYEKELKLLRQENRKNMLLSVA |
| .I.GLEEKLSQCQR.LEAVNSRLHRAELSPEAR.SLEKEKNSLMSKASN.EKELKLLRQENRKNMLLSVA | |
| Retrocopy | EISGLEEKLSQCQRALEAVNSRLHRAELSPEARRSLEKEKNSLMSKASNCEKELKLLRQENRKNMLLSVA |
| Parental | IFILLTLVYAYWT |
| IFILLTLVYAY.T | |
| Retrocopy | IFILLTLVYAYCT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000012069 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000030835 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000005622 | 2 retrocopies | |
| Felis catus | ENSFCAG00000006745 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024018 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000000921 | 1 retrocopy |
retro_ogar_880 ,
|
| Pongo abelii | ENSPPYG00000016563 | 1 retrocopy |