RetrogeneDB ID: | retro_opri_897 | ||
Retrocopy location | Organism: | Southern American pika (Ochotona princeps) | |
| Coordinates: | scaffold_4219:89233..89469(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSOPRG00000003411 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 51.22 % |
| Parental protein coverage: | 50.31 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | PDCRGCCQEEALETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRG-LQIKYVRGSDPVLKLLDDN |
| P...G.CQE.A....KLYAGA.L.V..........VQAFVRS.KPKL.R..L....V.G..PVLK...D. | |
| Retrocopy | PCSLGGCQEAA--PTKLYAGAVLKVGRREWKGSRRVQAFVRSGKPKLNRD<L*VTCV*GPAPVLKCFHDK |
| Parental | GNIAEELSILKW |
| G.IA.ELSIL.. | |
| Retrocopy | GKIAGELSILEY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000004701 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000005462 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000008134 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000003411 | 2 retrocopies |
retro_opri_157, retro_opri_897 ,
|
| Vicugna pacos | ENSVPAG00000011775 | 1 retrocopy |