RetrogeneDB ID: | retro_pabe_435 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 1:118032311..118032533(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COA5 | ||
Ensembl ID: | ENSPPYG00000012085 | ||
Aliases: | COA5, C2orf64 | ||
Description: | Cytochrome c oxidase assembly factor 5 [Source:UniProtKB/Swiss-Prot;Acc:Q5RFJ0] |
Percent Identity: | 74.32 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MPKYYEDKPQGGACGGLKEDLGACLLESDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFRG |
MP.YY.DK..G..C.G.KEDLG.CLL.S.CVVQEGKSP.QCLKEGYC..LKY.FFE.KRSVLD.R.R.RG | |
Retrocopy | MPQYYKDKLEGCVCAGVKEDLGVCLLQSNCVVQEGKSPLQCLKEGYCKALKYSFFEYKRSVLDTRSRIRG |
Parental | RKGY |
RKGY | |
Retrocopy | RKGY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 20 .84 RPM |
SRP007412_cerebellum | 0 .00 RPM | 26 .39 RPM |
SRP007412_heart | 0 .00 RPM | 12 .19 RPM |
SRP007412_kidney | 0 .03 RPM | 23 .97 RPM |
SRP007412_liver | 0 .00 RPM | 17 .99 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_204 |
Pan troglodytes | retro_ptro_340 |
Gorilla gorilla | retro_ggor_278 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000007139 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000009263 | 1 retrocopy | |
Equus caballus | ENSECAG00000004183 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000013626 | 1 retrocopy | |
Felis catus | ENSFCAG00000004424 | 1 retrocopy | |
Homo sapiens | ENSG00000183513 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000006019 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000013167 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000001197 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000001998 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000002972 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000012085 | 1 retrocopy |
retro_pabe_435 ,
|
Pan troglodytes | ENSPTRG00000012267 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000001578 | 1 retrocopy | |
Sorex araneus | ENSSARG00000006275 | 1 retrocopy |