RetrogeneDB ID: | retro_pabe_615 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 10:91324903..91325194(-) | ||
| Located in intron of: | ENSPPYG00000002484 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL11 | ||
| Ensembl ID: | ENSPPYG00000001736 | ||
| Aliases: | None | ||
| Description: | 60S ribosomal protein L11 [Source:RefSeq peptide;Acc:NP_001125385] |
| Percent Identity: | 75.51 % |
| Parental protein coverage: | 53.93 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | TVRGAKAEEILEKGLKVREYELRKNNF--SDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFS |
| T...AKAEE.LEKGLK..E.E.RKNNF..SDTGNFG..IQEHIDLGIK.DP.IGIY.LDFY.VLGRPGFS | |
| Retrocopy | TAQRAKAEETLEKGLKMQECESRKNNFNFSDTGNFGLEIQEHIDLGIKCDPCIGIYSLDFYMVLGRPGFS |
| Parental | IADKKRRTGCIGAKHRISKEEAMRWFQQ |
| .AD...RTGC.GAKHRI.K.EAMRWFQ. | |
| Retrocopy | TADT*HRTGCTGAKHRINK-EAMRWFQK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 192 .85 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 179 .24 RPM |
| SRP007412_heart | 0 .00 RPM | 198 .35 RPM |
| SRP007412_kidney | 0 .00 RPM | 581 .36 RPM |
| SRP007412_liver | 0 .00 RPM | 455 .75 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_712 |
| Gorilla gorilla | retro_ggor_603 |
| Macaca mulatta | retro_mmul_2462 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000020905 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000013232 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000020953 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000011230 | 2 retrocopies | |
| Homo sapiens | ENSG00000142676 | 6 retrocopies | |
| Gorilla gorilla | ENSGGOG00000014628 | 6 retrocopies | |
| Loxodonta africana | ENSLAFG00000030853 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000013738 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000002445 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000012828 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000059291 | 3 retrocopies | |
| Ornithorhynchus anatinus | ENSOANG00000000321 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000022928 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000001736 | 6 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000004282 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000026260 | 9 retrocopies | |
| Sus scrofa | ENSSSCG00000024260 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000001349 | 6 retrocopies |