RetrogeneDB ID: | retro_ptro_1060 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 15:54651983..54652264(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFB10 | ||
Ensembl ID: | ENSPTRG00000007618 | ||
Aliases: | None | ||
Description: | Pan troglodytes NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10), nuclear gene encoding mitochondrial protein, mRNA. [Source:RefSeq mRNA;Acc:NM_001071824] |
Percent Identity: | 75.79 % |
Parental protein coverage: | 54.65 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MYEAEMQWRRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQ-FTQVAKAYQDRYQDLGAYSSAR |
.YEAEMQWRRDYKVDQEI..I.Q.RLK.CQ..E..N..QN..KEVE..FTQVAKAYQDRYQDLGA..SAR | |
Retrocopy | IYEAEMQWRRDYKVDQEIVSIIQERLKTCQ*WEEDNHRQNWAKEVEH<FTQVAKAYQDRYQDLGAHHSAR |
Parental | KCLAKQRQRMLQERKAAKEAAAATS |
KC.AKQ.QRML.ERKAAKEA.AA.S | |
Retrocopy | KCRAKQKQRMLEERKAAKEATAAAS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 54 .87 RPM |
SRP007412_cerebellum | 0 .00 RPM | 37 .39 RPM |
SRP007412_heart | 0 .00 RPM | 111 .19 RPM |
SRP007412_kidney | 0 .00 RPM | 91 .98 RPM |
SRP007412_liver | 0 .00 RPM | 49 .13 RPM |
SRP007412_testis | 0 .00 RPM | 38 .46 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1573 |
Gorilla gorilla | retro_ggor_1198 |
Pongo abelii | retro_pabe_1297 |
Macaca mulatta | retro_mmul_2218 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000019476 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000017154 | 1 retrocopy | |
Felis catus | ENSFCAG00000011738 | 1 retrocopy | |
Homo sapiens | ENSG00000140990 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000009367 | 2 retrocopies | |
Latimeria chalumnae | ENSLACG00000013152 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000029268 | 1 retrocopy | |
Mus musculus | ENSMUSG00000040048 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000008867 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000006974 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000007618 | 2 retrocopies |
retro_ptro_1060 , retro_ptro_2578,
|
Rattus norvegicus | ENSRNOG00000014568 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000030328 | 1 retrocopy |