RetrogeneDB ID: | retro_ptro_1493 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 22:40867315..40867633(+) | ||
| Located in intron of: | ENSPTRG00000042031 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C6ORF108 | ||
| Ensembl ID: | ENSPTRG00000029662 | ||
| Aliases: | None | ||
| Description: | Chromosome 6 open reading frame 108 [Source:UniProtKB/TrEMBL;Acc:K7CVK4] |
| Percent Identity: | 71.03 % |
| Parental protein coverage: | 99.07 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | EEAAGGDRLIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAAD |
| ...AGGDRLIHE..L.WLQ.ADVVVAEVTQ.SLG.GY.LG.A.A.NK.ILCL..PQSG.VLSAMI...AD | |
| Retrocopy | DKSAGGDRLIHEWYLMWLQKADVVVAEVTQLSLGIGYDLGQATALNK*ILCLLQPQSGGVLSAMIWEEAD |
| Parental | GSRFQVWDYEEGEVEALLDRYFEADPPGQVAASPDPT |
| GS.FQVWDY.EG.VEALL....EADP..QV.ASP.PT | |
| Retrocopy | GSGFQVWDYGEGKVEALLHG*VEADPLEQV-ASPNPT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .98 RPM | 22 .72 RPM |
| SRP007412_cerebellum | 1 .61 RPM | 9 .11 RPM |
| SRP007412_heart | 0 .17 RPM | 8 .69 RPM |
| SRP007412_kidney | 1 .12 RPM | 95 .66 RPM |
| SRP007412_liver | 2 .55 RPM | 56 .27 RPM |
| SRP007412_testis | 1 .69 RPM | 2 .11 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2562 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012390 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000019913 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000001837 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000005337 | 1 retrocopy | |
| Equus caballus | ENSECAG00000006660 | 1 retrocopy | |
| Felis catus | ENSFCAG00000009722 | 1 retrocopy | |
| Homo sapiens | ENSG00000112667 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000516 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016635 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000029662 | 1 retrocopy |
retro_ptro_1493 ,
|
| Pteropus vampyrus | ENSPVAG00000008743 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000018397 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000007022 | 1 retrocopy |