RetrogeneDB ID: | retro_ptro_2551 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 7:94313333..94313758(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TSN | ||
Ensembl ID: | ENSPTRG00000012420 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 62.33 % |
Parental protein coverage: | 63.16 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | YRFHEHWRFVLQRLVFLAAFVVYLETETLVTREAVTEILGIEPDREKGFHLDVEDYLSGVL-ILASELSR |
...HEHWRFVLQ..V.....V..LETE...T.EA.TEI..IEPD.EK.FH.DVED.LSGV..ILASEL.R | |
Retrocopy | HEVHEHWRFVLQHTVVFPELVACLETE---TPEAITEIRVIEPDKEKRFHVDVEDPLSGVQ<ILASELLR |
Parental | LSVNSVTAGDYSRPLHISTFINELDSGFRLLNLKN-DSLRKRYDGLKYDVKKVEEVVYDLSIRGFNKETA |
LS.....AGD.S.PLH..TF.NE....F.LL.LK...SLRK.YDGL..DVKK.EEV.Y.LSI.GFNKE.. | |
Retrocopy | LSLSGMSAGDNSQPLHVATFNNEWHPNFHLLSLKHYSSLRKPYDGLW*DVKKTEEVFYILSIQGFNKEIE |
Parental | AACVEK |
AAC.EK | |
Retrocopy | AACTEK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 35 .18 RPM |
SRP007412_cerebellum | 0 .00 RPM | 44 .88 RPM |
SRP007412_heart | 0 .03 RPM | 26 .87 RPM |
SRP007412_kidney | 0 .00 RPM | 46 .84 RPM |
SRP007412_liver | 0 .00 RPM | 32 .01 RPM |
SRP007412_testis | 0 .00 RPM | 97 .16 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3760 |
Gorilla gorilla | retro_ggor_2528 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000006059 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000025740 | 2 retrocopies | |
Felis catus | ENSFCAG00000027149 | 1 retrocopy | |
Homo sapiens | ENSG00000211460 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000002216 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000012656 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000021119 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000000147 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000001202 | 1 retrocopy | |
Ornithorhynchus anatinus | ENSOANG00000003457 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000023529 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000030436 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000012420 | 1 retrocopy |
retro_ptro_2551 ,
|
Tarsius syrichta | ENSTSYG00000004395 | 1 retrocopy |