RetrogeneDB ID: | retro_ptro_3041 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | GL392075.1:7388991..7389204(+) | ||
Located in intron of: | ENSPTRG00000005848 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TIMM9 | ||
Ensembl ID: | ENSPTRG00000006394 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 70.42 % |
Parental protein coverage: | 79.78 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEY |
MAAQIPESDQIKQFKE.L.T......T.F...VKDFTTRE.KPEET..SEHCL.KY....QRI.MRFQEY | |
Retrocopy | MAAQIPESDQIKQFKECLATTRNFQKTAFFY*VKDFTTRELKPEETIRSEHCLRKYF*IMQRITMRFQEY |
Parental | H |
H | |
Retrocopy | H |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 7 .61 RPM |
SRP007412_cerebellum | 0 .00 RPM | 5 .13 RPM |
SRP007412_heart | 0 .00 RPM | 6 .38 RPM |
SRP007412_kidney | 0 .00 RPM | 9 .36 RPM |
SRP007412_liver | 0 .00 RPM | 6 .45 RPM |
SRP007412_testis | 0 .00 RPM | 4 .74 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1260 |
Pongo abelii | retro_pabe_1049 |