RetrogeneDB ID: | retro_ptro_408 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 10:8829738..8830017(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | OOEP | ||
Ensembl ID: | ENSPTRG00000029545 | ||
Aliases: | None | ||
Description: | oocyte expressed protein [Source:HGNC Symbol;Acc:21382] |
Percent Identity: | 68.42 % |
Parental protein coverage: | 63.76 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | VFYLEAWLADELFGPDRAIIPEMEWTSQALLTVDIVDSGNLVEITVFGRPRVQNRVKSMLLCLAWFHREH |
VFYLE....D..FG....IIPEMEW.SQALL.VD.VDS.NLVEITVFG.P.VQN.VKS.L.CLAWFH..H | |
Retrocopy | VFYLEEYAMDKIFG--QTIIPEMEWMSQALLMVDPVDSRNLVEITVFG*PCVQNWVKSLLPCLAWFHQKH |
Parental | RARAEKMKHLEKNLKAHASDPHSPQ |
.A...K.KHLEKN.KA.AS.PH.PQ | |
Retrocopy | HA*TVKKKHLEKNVKACASGPHAPQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .02 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .07 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .03 RPM |
SRP007412_liver | 0 .00 RPM | 0 .03 RPM |
SRP007412_testis | 0 .00 RPM | 3 .48 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000009962 | 1 retrocopy | |
Homo sapiens | ENSG00000203907 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000016832 | 3 retrocopies | |
Loxodonta africana | ENSLAFG00000012754 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000017174 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000000416 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000001204 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000025904 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000029545 | 3 retrocopies |
retro_ptro_3197, retro_ptro_329, retro_ptro_408 ,
|
Rattus norvegicus | ENSRNOG00000025957 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000001487 | 2 retrocopies |