RetrogeneDB ID: | retro_ptro_575 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 11:111681692..111681989(+) | ||
Located in intron of: | ENSPTRG00000004297 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX7A2L | ||
Ensembl ID: | ENSPTRG00000011865 | ||
Aliases: | None | ||
Description: | cytochrome c oxidase subunit VIIa polypeptide 2 like [Source:HGNC Symbol;Acc:2289] |
Percent Identity: | 78.79 % |
Parental protein coverage: | 86.84 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKA |
MYYKFSGFT..L.GAW.SEAYSP.GL.PVVSTEAPPIIFA.PTKLTSDST.Y..A.KNKVPELQKF.QKA | |
Retrocopy | MYYKFSGFTFELVGAWTSEAYSP*GLMPVVSTEAPPIIFAIPTKLTSDSTAYNFARKNKVPELQKFLQKA |
Parental | DGVPVYLKRGLPDQMLYRTTMALTVGGTI |
D.VP..LK.G.PDQMLY.TTM.LTVGG.. | |
Retrocopy | DDVPIHLK*GFPDQMLYWTTMVLTVGGIL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .04 RPM | 44 .92 RPM |
SRP007412_cerebellum | 0 .04 RPM | 34 .06 RPM |
SRP007412_heart | 0 .06 RPM | 47 .07 RPM |
SRP007412_kidney | 0 .03 RPM | 72 .99 RPM |
SRP007412_liver | 0 .00 RPM | 32 .73 RPM |
SRP007412_testis | 0 .00 RPM | 34 .67 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_825 |
Gorilla gorilla | retro_ggor_674 |
Pongo abelii | retro_pabe_737 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Echinops telfairi | ENSETEG00000011940 | 1 retrocopy | |
Homo sapiens | ENSG00000115944 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000010739 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000016278 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000008875 | 1 retrocopy | |
Mus musculus | ENSMUSG00000024248 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000016666 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000027189 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000016029 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000010888 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000011865 | 1 retrocopy |
retro_ptro_575 ,
|
Ictidomys tridecemlineatus | ENSSTOG00000012922 | 1 retrocopy |