RetrogeneDB ID: | retro_ptro_125 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 4:99328025..99328268(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSPTRG00000018353 | |
Aliases: | None | ||
Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX7A1 | ||
Ensembl ID: | ENSPTRG00000010888 | ||
Aliases: | None | ||
Description: | cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) [Source:HGNC Symbol;Acc:2287] |
Percent Identity: | 57.58 % |
Parental protein coverage: | 83.54 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | RSFSSTARNRFQNRVREKQKFFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFP |
R..S......F.N.V.EKQK.FQED..IPLYLKGGI.D..L.R.TM.L..GGT.Y..Y.L..ASFP | |
Retrocopy | RTISTASHRHFKNKVPEKQKLFQEDDGIPLYLKGGIADALLHRATMILTVGGTAYAIYQLAVASFP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 46 .42 RPM |
SRP007412_cerebellum | 0 .32 RPM | 8 .50 RPM |
SRP007412_heart | 0 .64 RPM | 319 .27 RPM |
SRP007412_kidney | 0 .39 RPM | 75 .84 RPM |
SRP007412_liver | 0 .29 RPM | 3 .54 RPM |
SRP007412_testis | 5 .16 RPM | 0 .84 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2961 |
Gorilla gorilla | retro_ggor_2051 |
Pongo abelii | retro_pabe_2456 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000012840 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000007654 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000012331 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000000250 | 3 retrocopies | |
Monodelphis domestica | ENSMODG00000025577 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000010888 | 1 retrocopy |
retro_ptro_125 ,
|
Pan troglodytes | ENSPTRG00000011865 | 1 retrocopy |