RetrogeneDB ID: | retro_ptro_593 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 11:17230328..17230574(-) | ||
| Located in intron of: | ENSPTRG00000003403 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SDHC | ||
| Ensembl ID: | ENSPTRG00000001585 | ||
| Aliases: | None | ||
| Description: | succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa [Source:HGNC Symbol;Acc:10682] |
| Percent Identity: | 87.8 % |
| Parental protein coverage: | 54.67 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSIC |
| MAALLLRHVG.HCLRAHFSPQLC.RNAVPLG.TAKEEM..FWNKN..SN.P.SPHITIYSWSLPMAMSIC | |
| Retrocopy | MAALLLRHVGCHCLRAHFSPQLCTRNAVPLGITAKEEMGQFWNKNTSSNCPKSPHITIYSWSLPMAMSIC |
| Parental | HRGTGIALSADV |
| HRGTGIALSA.V | |
| Retrocopy | HRGTGIALSAGV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 2 .79 RPM | 52 .62 RPM |
| SRP007412_cerebellum | 2 .83 RPM | 39 .54 RPM |
| SRP007412_heart | 3 .53 RPM | 90 .53 RPM |
| SRP007412_kidney | 9 .62 RPM | 137 .85 RPM |
| SRP007412_liver | 2 .29 RPM | 52 .15 RPM |
| SRP007412_testis | 0 .84 RPM | 26 .14 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000015351 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000015853 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000012992 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000004757 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000015767 | 1 retrocopy | |
| Felis catus | ENSFCAG00000000499 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000012411 | 11 retrocopies | |
| Mustela putorius furo | ENSMPUG00000014439 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000001585 | 4 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000005544 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000003163 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000016835 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000030318 | 2 retrocopies | |
| Takifugu rubripes | ENSTRUG00000001873 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000009234 | 1 retrocopy |