RetrogeneDB ID: | retro_ptro_898 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 14:25060266..25060471(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CYB5A | ||
Ensembl ID: | ENSPTRG00000010111 | ||
Aliases: | None | ||
Description: | cytochrome b5 type A (microsomal) [Source:HGNC Symbol;Acc:2570] |
Percent Identity: | 68.57 % |
Parental protein coverage: | 51.49 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | EDVGHSTDAREMSKTFIIGE-LHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMA |
ED..HSTDA.E.SKT.IIG..L.PDDR...N...ETL.TT.DS.SS.WTNWVIPAISA..VAL.Y.LYMA | |
Retrocopy | EDIMHSTDATELSKTYIIGG>LYPDDRSITNLS-ETLFTTVDSHSS*WTNWVIPAISALTVALRYHLYMA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 14 .76 RPM |
SRP007412_cerebellum | 0 .00 RPM | 12 .91 RPM |
SRP007412_heart | 0 .00 RPM | 18 .01 RPM |
SRP007412_kidney | 0 .00 RPM | 290 .13 RPM |
SRP007412_liver | 0 .00 RPM | 357 .62 RPM |
SRP007412_testis | 0 .00 RPM | 19 .39 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1307 |
Pongo abelii | retro_pabe_1094 |
Macaca mulatta | retro_mmul_2162 |
Callithrix jacchus | retro_cjac_686 |