RetrogeneDB ID: | retro_pvam_1461 | ||
Retrocopylocation | Organism: | Megabat (Pteropus vampyrus) | |
Coordinates: | scaffold_9182:18014..18234(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBL5 | ||
Ensembl ID: | ENSPVAG00000008628 | ||
Aliases: | None | ||
Description: | ubiquitin-like 5 [Source:HGNC Symbol;Acc:13736] |
Percent Identity: | 78.38 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTI-FKDHVSLGDYEIHDGMNLE |
M.EVVCND.LGKKV..KCNTDDTI.DLKKLI.A.TG...NKI..K.WY.I.FKDHVSLGDYEIHD.MNLE | |
Retrocopy | MTEVVCNDHLGKKVHMKCNTDDTIKDLKKLITA*TGIYCNKIIMKNWYII>FKDHVSLGDYEIHDWMNLE |
Parental | LYYQ |
LYYQ | |
Retrocopy | LYYQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000006097 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000006384 | 5 retrocopies | |
Homo sapiens | ENSG00000198258 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000005999 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000012892 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000015506 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000027369 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000007877 | 2 retrocopies | |
Mus musculus | ENSMUSG00000084786 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000009536 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000010451 | 3 retrocopies | |
Pteropus vampyrus | ENSPVAG00000008628 | 1 retrocopy |
retro_pvam_1461 ,
|
Sarcophilus harrisii | ENSSHAG00000010974 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000023331 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000008535 | 1 retrocopy |