RetrogeneDB ID: | retro_pvam_780 | ||
Retrocopy location | Organism: | Megabat (Pteropus vampyrus) | |
| Coordinates: | scaffold_11417:13601..13829(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPVAG00000003521 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 73.08 % |
| Parental protein coverage: | 54.29 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | KLRKKTSDIILVGLR-DYQDNKADVI-LKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIG |
| K.RK..SDIIL.GL..DYQ.NKADVI.LKYNADEARSL..YG.LP.HAK..ETDT.G.GD.DEIQFD.I. | |
| Retrocopy | KVRKNISDIILIGLQ<DYQANKADVI>LKYNADEARSLETYGKLPDHAKFSETDTLGLGDNDEIQFDNIR |
| Parental | DDDEDIDD |
| DD..DIDD | |
| Retrocopy | DDEDDIDD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000005371 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000011536 | 1 retrocopy | |
| Homo sapiens | ENSG00000173674 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000012186 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000012977 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000027820 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000067194 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000008182 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000022504 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000003521 | 2 retrocopies |
retro_pvam_780 , retro_pvam_92,
|
| Rattus norvegicus | ENSRNOG00000005736 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000029864 | 1 retrocopy |