RetrogeneDB ID: | retro_sscr_196 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 1:255051961..255052206(-) | ||
| Located in intron of: | ENSSSCG00000005273 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSSCG00000023777 | ||
| Aliases: | None | ||
| Description: | Sus scrofa ATP synthase, H+ transporting, mitochondrial Fo complex, subunit G (ATP5L), nuclear gene encoding mitochondrial protein, mRNA. [Source:RefSeq mRNA;Acc:NM_001244137] |
| Percent Identity: | 80.72 % |
| Parental protein coverage: | 79.61 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | VRNLAEKAPVLVNAAVTYSKPRLATFWHYAKVELVPPTPAEIPTAIQSLK-KIVNSAQTGSFKQLTVKEA |
| V.NL.EKA.VLVNAAVTY.KP.LAT.WHYAKVELVPP.PAEIP.AIQSLK.K.VNSAQTGS.KQLTVK.A | |
| Retrocopy | VCNLVEKAQVLVNAAVTYWKPLLATVWHYAKVELVPPVPAEIPAAIQSLK<KPVNSAQTGSLKQLTVKKA |
| Parental | LLNGLVATEVLMW |
| LLN.L.ATEV.M. | |
| Retrocopy | LLNCLEATEV*MY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 76 .32 RPM |
| SRP014902_testis | 0 .00 RPM | 71 .85 RPM |
| SRP018288_heart | 0 .03 RPM | 330 .98 RPM |
| SRP018288_kidney | 0 .00 RPM | 361 .02 RPM |
| SRP018288_liver | 0 .00 RPM | 120 .57 RPM |
| SRP018288_lung | 0 .10 RPM | 49 .59 RPM |
| SRP018856_adipose | 0 .00 RPM | 74 .76 RPM |
| SRP035408_brain | 0 .00 RPM | 153 .72 RPM |
| SRP035408_liver | 0 .06 RPM | 112 .11 RPM |