RetrogeneDB ID: | retro_sscr_844 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 6:76956226..76956610(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | KIAA1143 | ||
| Ensembl ID: | ENSSSCG00000011308 | ||
| Aliases: | None | ||
| Description: | KIAA1143 [Source:HGNC Symbol;Acc:29198] |
| Percent Identity: | 65.91 % |
| Parental protein coverage: | 82.58 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 3 |
| Parental | MSKRNQVSYVRPAEPAFLARFKERVGYREGPTIETKR-IQPQLPDEDADHSDKEDEQPQ-VVVLKKGDLS |
| .SK.NQV.Y......AFLA.FKE.VG.REG...ETK..I.PQLPDED.DHSDKE......VVVLKK..LS | |
| Retrocopy | ISKQNQVIYMGLVKSAFLACFKEWVGCREGTPEETKE<ILPQLPDEDGDHSDKENNTSK<VVVLKKRALS |
| Parental | -EEVMKIKAEIKAAKADEEPASADGRIMYRKPVKRSSDEKYSGLTASS-KKKKTNEEDVINK |
| .EEV.KIKAEIKAA.ADEEPASADGR..Y.KPVK..SDEKY.GLTASS.KK...N..D...K | |
| Retrocopy | AEEVRKIKAEIKAARADEEPASADGRMLY*KPVKCCSDEKYLGLTASS<KKRR*NK*DLVKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 1 .59 RPM |
| SRP014902_testis | 0 .00 RPM | 4 .38 RPM |
| SRP018288_heart | 0 .00 RPM | 6 .94 RPM |
| SRP018288_kidney | 0 .00 RPM | 5 .12 RPM |
| SRP018288_liver | 0 .00 RPM | 2 .88 RPM |
| SRP018288_lung | 0 .00 RPM | 2 .95 RPM |
| SRP018856_adipose | 0 .00 RPM | 4 .34 RPM |
| SRP035408_brain | 0 .00 RPM | 16 .83 RPM |
| SRP035408_liver | 0 .00 RPM | 5 .96 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000014132 | 1 retrocopy | |
| Homo sapiens | ENSG00000163807 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005987 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000000929 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000013954 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000014824 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000012438 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000011308 | 2 retrocopies |
retro_sscr_844 , retro_sscr_874,
|
| Ictidomys tridecemlineatus | ENSSTOG00000010817 | 1 retrocopy |