RetrogeneDB ID: | retro_tbel_1328 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
Coordinates: | GeneScaffold_4400:586408..586673(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | GINS2 | ||
Ensembl ID: | ENSTBEG00000006220 | ||
Aliases: | None | ||
Description: | GINS complex subunit 2 (Psf2 homolog) [Source:HGNC Symbol;Acc:24575] |
Percent Identity: | 64.13 % |
Parental protein coverage: | 67.67 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | LWLAVNLKQRQKCRLLPPEWMDVENLEK-IKDHEQKEETFTPMPSPYYMELTKLLLNHAADNIPKADAIR |
LWLA.NLKQ..K..LL..EW.D.E.L...I.DHE...ETFTPMPSPYYM.L.KLLLNHA.D.I.KA..IR | |
Retrocopy | LWLAINLKQT*KGWLLCTEWVDMEKLGS<IRDHEYEGETFTPMPSPYYMVLSKLLLNHASD-IWKANEIR |
Parental | -TLIKDMWDTRLAKLRVSADSF |
.TLIK.MWDT...K..VS.D.F | |
Retrocopy | <TLIKAMWDTTIDKFWVSTDRF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000017303 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000008760 | 4 retrocopies | |
Homo sapiens | ENSG00000131153 | 1 retrocopy | |
Gallus gallus | ENSGALG00000028131 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000009069 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000014703 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000016691 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000020594 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000007616 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000008430 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000004944 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000015249 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000002663 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000006220 | 1 retrocopy |
retro_tbel_1328 ,
|