RetrogeneDB ID: | retro_tsyr_1550 | ||
Retrocopylocation | Organism: | Tarsier (Tarsius syrichta) | |
Coordinates: | scaffold_48628:2020..2234(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSTSYG00000009556 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 74.32 % |
Parental protein coverage: | 69.23 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | MIGDILLFG-TLLMNAGAVLNFKLKKKDTQGFGEESREPSTGDNIRE-ILLSIRYFRIFIALWNVFMMFC |
M.G.ILL.G.T.LMNAGA.LNFKLKKK..QGFGEES..PSTGDNIRE.IL.S..YF.IFI.L.N.FMMFC | |
Retrocopy | MVGVILLLG<TPLMNAGAMLNFKLKKKGMQGFGEESCDPSTGDNIRE<ILMSLGYFGIFISL*NGFMMFC |
Parental | MIVL |
.IVL | |
Retrocopy | VIVL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000010105 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000015643 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000013936 | 1 retrocopy | |
Equus caballus | ENSECAG00000026861 | 1 retrocopy | |
Felis catus | ENSFCAG00000016411 | 1 retrocopy | |
Homo sapiens | ENSG00000214046 | 1 retrocopy | |
Mus musculus | ENSMUSG00000044600 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000005569 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000009694 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000010650 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000042037 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000013863 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000009556 | 1 retrocopy |
retro_tsyr_1550 ,
|
Tursiops truncatus | ENSTTRG00000015020 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000006699 | 1 retrocopy |